PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS65844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 73aa    MW: 8894.12 Da    PI: 11.1549
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS65844.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.93.1e-221068356
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56
                +R+++t+eql+ Leel+++ +r+ps e++++++ +l    +++ ++V++WFqN++a+e+
  EPS65844.1 10 SRWCPTPEQLQSLEELYRRgTRTPSSEQIQQITCQLrrygKIEAKNVFYWFQNHKARER 68
                7*****************99*************************************98 PP

2Wus_type_Homeobox115.33e-37970364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++RW+PtpeQ++ Leely++G+rtP++e+iq+it +L++yGkie kNVfyWFQN+kaRer k
         EPS65844.1  9 SSRWCPTPEQLQSLEELYRRGTRTPSSEQIQQITCQLRRYGKIEAKNVFYWFQNHKARERLK 70
                       79**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0065773IPR001356Homeobox domain
PfamPF000464.6E-201068IPR001356Homeobox domain
SuperFamilySSF466891.75E-121068IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-101068IPR009057Homeodomain-like
CDDcd000869.39E-41168No hitNo description
PROSITE profilePS5007110.9811570IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
VNSQQVVVSS RWCPTPEQLQ SLEELYRRGT RTPSSEQIQQ ITCQLRRYGK IEAKNVFYWF  60
QNHKARERLK RRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853221.16e-39PREDICTED: WUSCHEL-related homeobox 1-like
SwissprotQ6X7K07e-35WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLS8CG272e-47S8CG27_9LAMI; Uncharacterized protein (Fragment)
STRINGGLYMA05G33850.22e-35(Glycine max)
STRINGGLYMA08G05831.11e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.14e-36WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]